TCDB is operated by the Saier Lab Bioinformatics Group
>WP_048042267.1 two pore domain potassium channel family protein [Methanosarcina mazei]
MFLNTVKTLLKDPKFRSLLYLTTLTLASGTFFYHSVEGWSWLDSFYFSVITLATVGYGDFTPQTDLGKIFTVIYIFLGLG
IFVGFVTPIGEYLIDKRMENIDKKMREKENSQIKNQKNPETEYQTRINLSGIIGKLKGKK