TCDB is operated by the Saier Lab Bioinformatics Group
>WP_048600992.1 ATP-binding cassette domain-containing protein [Rubeoparvulum massiliense]
MPNEIAVRAENLVKVFSGMEVIKGCNLSVKQGTIYGFLGLNGAGKTTVLKMLMGLLTPTAGKVTVFGKDMAIHRDELLRN
IGSIIEAPIFYEHLSAEENLSLHLEYMNMQDVNISEVLEKVGLAHTRSQPVSKFSIGMRQRLGIARAIIHKPKLLLLDEP
INGLDPIGILEMRKLFLDLAHNRGVTMIISSHILSEIEHIADTVGIIANGIIKQEISMVQINKELQSDLEGYFFELMGGG
YKDV