TCDB is operated by the Saier Lab Bioinformatics Group
>WP_052823361.1 exosortase/archaeosortase family protein [Tamlana sedimentorum]
MLNIKKSLNNIPKPIRLFLGKALLFFIVWKLVYGFYLSNTKVLDYPLTKHVGEASTYLLNNFSPMSGFTVERNVGTFYIG
DELVEGSISSQIFHNDYLVLHIADNCNGLELIVLFIGFIICMPSSFWRKLLYIAIGIIIIDFVNILRCMGLIYLREYYHA
YFDFAHHYLFKAIVYTCTFLMWMYFSRKISFKNENLQIG