TCDB is operated by the Saier Lab Bioinformatics Group
>WP_064220474.1 hypothetical protein [Anoxybacillus flavithermus]
MKTIKILIATTLKLHRYLLSIGLMLLYAYAGLIDYALMFKGKDVGDALQLSSFLIQSGMLFFILLGFRIARKTTVEETLQ
QIVKRKITAIHLFNVVFLLFIAIFYVLTMMAFNLIYYYWMDPYNSFGLESSLFLINYWLLPFCTSSLIGYIFGMNSSNKI
AYALLLIIWASISPANLNFLRELFANTQLQEVMEWLKNLNFGVYNLSDLYHPFYGFEFDWLKKIGLLLLLVFVYVLSIFT
VNIKCLRRFNLVMIILGLILFGSMPYDFVKPKIYDVKTLVQEYISYSKKENIPKANLFEYDIEGMDVKVENFDHFNVSVD
VRVTKFKKTELAFTLYRGFRINKIMLSSGREVPFVQKGDHIIVKLSEKLNMDSVTLTFTYSGKGSLSNPAMGKYIYLPSD
FGWLPSNQPYAVRFLFNDEFITSSLKNKNNIKYTLSYKGIGKPTFVNLPKTSDGKYAGNTTGITLISGDLVHVKRDKRTM
YYPVSWFLYKEELESYLNEYQKVLEKYNGIFKTNYKLPNNIILLPNMDINDTYIYINSFSDSDHIILQINPVEFTKKMPI
NHLVPYQIDRTFSTNNTFNNPKKFANWFIYNSLLGSYLSDKPKDSIQALKDYQMYLAESYLDEKGKVILAQLLKIDEKKL
PDELFVRWKDILLDEDKNDWKQIEKTLLQLGLLKENDR