TCDB is operated by the Saier Lab Bioinformatics Group
>WP_065152054.1 DUF1707 domain-containing protein [Mycolicibacter heraklionensis]
MTTRFIAPSALAVRVGDAERGNTADHLGQAFTQGYLSMEEYETRLARAFEAQTAGALRDLLADLPVAQIIKRDPRRRAQR
SAAARRGVRIHLGAYLAVSVLMIGVWLVTAVFAGAWYFWPIWPILGWGIGIVSHAIPVGACGRGRACS