TCDB is operated by the Saier Lab Bioinformatics Group
>WP_066043202.1 hypothetical protein [Bathymodiolus septemdierum thioautotrophic gill symbiont]
MKILLSLILLAFMSLANANADNIIAHNNIQHCLMNEQSMDMSAEQHLSGCCDISCAQHLVTDAQITPLESYISQPLLVVV
NVDNFYTSFSSKMLLPPPIV