TCDB is operated by the Saier Lab Bioinformatics Group
>WP_066246636.1 hypothetical protein [Arcobacter porcinus]
MKKFNLSLIAVLAISSASVIHASTLQEALKDGKVSGEVTLTTEERYFKKDIDSYYRDSAYGVGSFALKYETGVWNNLSLT
SKTRAYKTIWEKSRTKPTDTGTGDATGRFYEKDGVKQTVDIESLFLEYTPNSNINVKAGRQDLNSDWMNKIHDAVKIEAN
FENTSIEAIWSIRDGRVHARDYRPLEKMNENKGVYKLGIKQKFNDNISATAYGLVFPDAKEIYGAKLNLAYDDTKARFHY
AYSDEGKSLDKNSFKDVKSDIIDIMFSTSLFGFSPYLGYAKVSDDLAFPGYTTNTKSRESGEIIVPFEEGDYFYSRGAST
IYVGIGKVIGDFNATFLYGNTKYYKDPEGQDNKKNTVDEATLWLGYKITSDLKSNLGYTYVNEKDTNIGEYNQVNLTFTY
SF