TCDB is operated by the Saier Lab Bioinformatics Group
>WP_067041512.1 ABC transporter ATP-binding protein [Methanobrevibacter sp. YE315]
MISEYFVERFGLTKEGSDNLIKGIIYTALLNIAFMLPVGLYALLLYMWVEPLTGGEIIEPNLGMFIVLILIVLGIIFALA
WKQYHFVFNTTYTESENRRINLGENLRKLPLSFFENRDLADLTATIMNDCTDLEHVFSHAIPQLLGSIISLVLVAIGLLT
FDWRLAIALLWPVPVAFAILYASKILIYKGGRIVMEDLLDCGDTMQECIESVRDLKSYNYQDEYYGKISSLTSKIEKSRI
KAELMASAGVITGKVVLNLGIVSVILLGSYLIMNSQVSLFTLLIFLIASATIYAPVENGLMFLSEILMMDIKIDRTKEIE
SLVVEEGLTEYSLNGYDIEFKNVDFNYDDLKNVLTDINFTAKQGEVTALVGPSGGGKSTVSKLAARFWDPVSGEVILGGQ
DLSKLDSEKLLENFSIVFQDVILFNTSILENIRVGKKDATDEEVIEAAKLAECDEFVSKLPDGYDTVIGENGELLSGGQR
QRISIARAMLKDANVILLDEATSFLDVENESKIQKALSELIRNKTVIIIAHRMRTIANADKIVVLDEGRIVEQGSPDELI
AQNGLFKKMVDLQNLSGEWVI