TCDB is operated by the Saier Lab Bioinformatics Group
>WP_068170239.1 hypothetical protein [Hydrogenophaga taeniospiralis]
MNMNALWDSLQSALGTHIPQLLGALAIFILGWLIAVVVRAAVRKSLGFVGVNHRFGKLTGTGVDIEGAVALGLFWIVILL
TLVAVFNSLNLAIVSGPFSAFTTQLFEYAPRVLGGLVLALVGWLVASVVRAVTQKLLDKTSLDESLSEHADMSPMSESLA
GALFWLVILLFVPAILGALQMDGLLDPLRAMVTKTLDMLPNAVAAFVIGGVGWILATVLRNLTTNLSRTAGVDKLGGRAG
LADTVRLSSVIGLLVFVAVFLPSLIAALDALKIEAISRPATNMLGLIMDAVPHIIAAGLILVVTWLVASFASKLLASLLA
TLGFDTLPARVGLAHAFVNTSASTAVGRVALFFAMLFATVEAAAQLGFVQVSDIVSTFIRFGGDVLLGSAVLVIGFWLAN
LAHDAIDRASGPDTKGLARVGRFAILALVIAMGLRAMGIADDIVNLAFGLTLGAVAVAVALSFGLGGREAAGKLMEHWLA
RFRRGE