TCDB is operated by the Saier Lab Bioinformatics Group
>WP_068691471.1 hypothetical protein [Culturomica massiliensis]
MNIHTINVIARYEVKLLKRSWLFRIFAILVLLILTLTQLSNLSPVFWKYSETWNYVGVTSLIPFFTTYLYNIAQSVIVVF
LAGSFLKRDKKLDTAEVIYVRPMSNADYIVGKVWGITRVFLGLNIITLLVGMFVNLVVGGSPFSIFPYLFYLFTISLPSL
WFVLGLSFTLMCILKNQAVTFIVMLGIIGTLFFYVGDNLYGVFDFFGVNIPAIFSDVTGHPDLALFLLQRTVYFLGGIAL
LCFTITLVKRLPHRPWKTVIINICAFVLLLVSVGTGFLYVRHFRHIAEVRKEYIALFDKYAVLPKADISSNDITIKQSGN
SLEAESRMLVKNSRGEMIPQVILYLNPGVEILGLEVAGQAVTYEREKQVLLIDQALQPGEEKQITIRYAGPLDENVCYTD
IDEKDFLANPTGNTFSFRYGKRYVYLEDRYTILTPECLWYPVAESPAYPAMPYNIKKEFTRYTLTVEHPENRTAISQGDA
VREEGKTVFSNATPLPCISVAIGDYEKKAISVDSTDYELYYFKGHDFFSKYFEEIQDTLPAIIREIRADLEVGKNRSYPF
SKFVMAETPLPFTGYIRNWKGYTEQVMPEIVFLPERGLRTQVDFRAEQHRIRDWRNQNDIPEDKEIQVQMLKNYINNTFV
AETSSDGSMRWSSSPEVNKLNIGAMFFGFTGFMYSADYPIIDVALNTMQNTSESNQRRWFFSTELSDNQRANVYLQDHSF
EAAMKDKNIKPQVFYEVLKLKSNFLKSFVVSQIPMKTFHSFLRNFNESHLFKETDLEEFSEKFKEEFHIDLADFIHQWYT
TDHAPEIKLKDVDVNQVILDDFTKYRISLKAYNPSDVDGMINVNVESGGGGMRGRGPRRPGSGEDEDNIHHYYIPAGSAR
EIKIINDDRPGRITVNTMVSRNLPNEFDFNFSKVDTEVSDTLTGAFPIDTAVFAAVPGEIIIDNEDPGFRTIEGNTRHKL
KDLFRKEEEDKYQNFMPWRYPSKWTAVVKSSCFGESVHSAVYKSKGTGANKVEWTAEIPKDNYYEIFVWNPKFEIWFWGR
HNRTRNDQTQTYTIAYDEEKETASVDFAQEENGWVSLGSYYLPAGRVTVTLTDKVSSVFVSADAVKFTLIK