TCDB is operated by the Saier Lab Bioinformatics Group
>WP_069282109.1 hypothetical protein [Sulfolobus sp. A20]
MADKLYEAFKYVIKYELKSSIRRYIVLGAFDGILLSLSILLSSVISHFPISDITIAVFSGTIATAVSSTWNALVVELGEK
KAELERLEKQVLKSLRGTIYDYSGKISAVLSAISHGASPFLGLLVLYAYQYSRNYLVSLILGLVFLGILGLLYGEKLRDK
ALTMVQLIIAGLITSFLMLFIVK