TCDB is operated by the Saier Lab Bioinformatics Group
>WP_072351900.1 hypothetical protein [Flavobacteriaceae bacterium A100]
MNTNNLIKLPYWIGIILDAIIGLLLLIPSLYSKTIGQGTNLDLQGQLNTSVGGLFIFSWTFLLIWAVKKPIERRFVGLLT
AIPVLFGLIVINTISYNNGKQLSLLFIIKLSIVFLLFLNSYYLADKISKKE