TCDB is operated by the Saier Lab Bioinformatics Group
>WP_076422674.1 SusF/SusE family outer membrane protein [Pontibacter lucknowensis]
MKSTINKLFTLCLMSLVLFSCEKDEERLVLRPGAAPTLAATENSVELTAETKGEDAITMNWTAADYGYQAAVTYTLQFIA
EGGDFEEAREIEATSGTTSRTLTVAELNTLATQLGLAPNNEGTIQARVRSSVAESVTPAYSNVVSFNVTPFLDIIEYVSL
WVPGSHQGWNPGEAPKVSSVNDNGVYEGYVNFPEAQTNFKFTPEPNWDNDFGGTSSGNKGTLTEKGDNLVVNGTGYYLLK
ANTNQMTWEAIRTTWGVIGDATAGGWDSDQDLSYNATEQVWKGTLKLSVGEIKFRANDAWDINLGDDNADASLEYGAANI
KIEEAGDYEVVLNLANPGNYTYSLTKL