TCDB is operated by the Saier Lab Bioinformatics Group
>WP_083289127.1 flippase-like domain-containing protein [Jiangella alba]
MARPGGMRSTTLSTASAYSSSIRPSCLTAARGPACDDAPSMTEPRDSDNTSADEIVVDEPPLPPRTRRPADVVSLLIVSG
VLTGLVAMSIIAERTMTAITEDLADLNTRVPGSIVGIVDFTANLAGVVIPIVLVAVLMIRGRVRTTVELLLAGVTASVAA
ALVSEWLTGPAPQRLHDSLVPIVDGAEATPVPAYSALLVAVVTVVSQLDVRRLRQVALFAIAGTYAVELLQGDATVGGLL
IATSVGVAAGLLVRIVGGQPSLAPSGQKIAATLEAAGYQLKALRADPSGDYRRLTAETPEARYSVLVLDRNHEGAGTIAR
TVDQLRTREEVLPRQTVTLRDAIDRIALQSFAVARAGARTPELRTVLRIDGDSAALVYDYVHGTALSDLTADDVTDDMLV
DLWRQLGDLRRGQVAHRRLSGRTIIADDSSRIWLLSPSGGELAATDIAMRTDLAQALTATSIVAGPERVVDTALEVLGPD
VVRAAIPLLQPIALTPGTRQHVKGHREVLIRLRDRLVDRLGAPAEPLRLQRIRPLSLLTGVGTVVAVYLVGTQLSDVSFT
ELWDRTDWRWLILAIGLMFTNYLTMALGLLGFVPERVPFWRVVGAQVAIGFLRLMAPTTVGNVAMNIRLLTKSGVAAPLA
AASVAANQVAQVAVTFPLLAVLAVVSGYNALPGLPSSSTLIVVLGLLLAASVVAIIPPVRSRLRTLWSDFAERGLPRLLD
VLSDPRKLAMAVGGILGQTASLILCFYACLLAVGETVNLAGLAVVQLVGNTLGTAVPTPGGLGAVEAALTAGVSTLGVPA
SAAVTAVLVFRIVSFWLPILPGWVLWTQMRRRDLL