TCDB is operated by the Saier Lab Bioinformatics Group
>WP_084871275.1 carbohydrate-binding domain-containing protein [Streptococcus salivarius]
MTYKDTKQTQERYAIKKSSKWKTAGSVLVASLIFGSSVVLNENKASADEANTESTLSTVTTGETTADLIEESVQTESSSN
TTETSTDTDTSTTTTTSDTASSATSTTSDITDTSTSSETSDHSSTSATSEASSSETATTTNETSETATTTTDESSATHTS
TSSTEATASETASVLTNNSSDTTSETTTTESSSDDSESTTTTITFNGTTVVTSDSSTVTVDGTTVTINQSGSYTLTGNGS
SYTIIVAGSVTDPVTIYLDGVILTDSSITSNSSAELTVNVLSDSSISSTSANAIEATGALTITSGTGSSLTLSSTEKHAI
KADSVTVDSVTLDLTSEAKDGINATTAVTIKNATVNITATDDGIQVEDETDVNSGDLTITDSTVTINATDKGITVTDELT
VEGNSKVTVVAGDEGLEGRYINLTGGTVDITAGDDGINATEWTTKDSADTSSLTNSTSDLENEVAINIDGATVTILADGD
GIDSNGNVTVKSGSLYVAQTSADNAAIDYDGTGIISGGIVWAIGNQGMAQAFTTGSSQSYIMANISGSAGDTITVTDSSG
NVVATTTATSSFGNVVFSTESLTSGETYTITTSSGSSATATATEEGTNNGPGAGGMGGFPGGSFDNTSMSDNFGGYGGPT
SYGGSSTNTGSINTPWGQSGSTSSENTSSTSTTSSTSQTANTGRPTPPNFASQTSSSSSTNTSTTASNSASQLAANASEL
TATNTALSSQSTSTSKTSNPEGASLKTNTSVANQSAEEQPTQSMTNATGVAQQEGQETAEKLDKIQAQNQTPEASKGQPR
EVSSQKENVSPVVQTNLAQKQNTQTSSKANQSDKSSQTNQTSKSSLPNTGDVSSLGLGALGAVLMTTSFALKGSKHSRK