TCDB is operated by the Saier Lab Bioinformatics Group
>WP_085549329.1 hypothetical protein [Corynebacterium pollutisoli]
MSSNLIEFFGTVGQLSSGYVTTEESVDDEGNVTVDEVTNETIFSYLFDLLGTAGDWAGAVANLIGLVP