TCDB is operated by the Saier Lab Bioinformatics Group
>WP_091089264.1 DUF819 domain-containing protein [Flavobacterium gillisiae]
MNENATALITNDAVVLGILMTILGLIFITSSSEKAFFKKFYSIVPSVLLCYFIPALFNTFNIISGETSSLYTIASRYLLP
ASLVLLTLSINFVALKKLGSKAIIMFLAGTLGIIIGGPIALYIVGSFFPEVALSNGEEVWKGLSTIAGSWIGGGANQTAM
LEVFGASKSMFAQMIAVDVLVANLWMGFLLYGAQKSDKIDKWLKADSAPIAELEKKLEEEQAGKRQPLTTNNLMVVLMVA
FGLTGLGHFLADILAPFFKENYPELEKYSFTNEFFWLVIITTTAGVLLSFTKVRKIESYGASKVGTVFLYILVATIGTHM
NLGAIFDNPLLFLVGIIWITTHIIVMIIVAKIIKAPFFYVAVGSQANIGGAASAPIVAAAFSPFLAPVGVLLAVLGYAVG
TYGAYVCGLLLHQIFIIIT