TCDB is operated by the Saier Lab Bioinformatics Group
>WP_094263337.1 hypothetical protein [Paludifilum halophilum]
MKQALDSWKIELRLLSRNYWSWIVLILTGIYIIFGFPEFLLQYDPGRTLMGSAYVVVGGILIFLIYGWSLIHKEKESQIE
EVIESLPHGIRGKILGKGLALVSVVALSMSYSMILVFYRFYKADVLSIFWVKAVPYLLLYWGLPFLVAGLLGMVIRLSIS
SKLSYLLILVVWILFSPLISILSDMNHSTPFISDWISKLQTFNLGQSDIHTPYDPVYGLPMEIYRWMKVLFWLLVSVFLL
CLRYLQKTHHSLFPTQGWYVSAGFLVLILPVLYLWNLPDQPRFEQGNRVTEDYRQYYGDHPKIHFKNGVPFTIHSY