TCDB is operated by the Saier Lab Bioinformatics Group
>WP_101456069.1 DUF2156 domain-containing protein [Bifidobacterium pseudolongum]
MNTNQSSVARPRRRAGSGVGAQLLADLRQWVHEQRFALWVTAGFVAINLCWWLFYAVQHKSLPYAELSTTLGAFDLARLL
PSLVLTRGVLQLIVEAVLILCVLCVAEPRMGAMRTTLVSLGSAAIGIGGGLLLCAGISTLFGDRALTSQIVFSLSPVTLV
AGALMASTAFSYALWRHRVRLIGYTAVLVVILYGGNPGDYCTLIAAVAGQLIGTAIAGRPHESERWHWQYSSSREKRRIL
GAIGFVLALGPVVTATSRIHAGPLTSLAWIMGPGSVHSSRLAACLNGEASLGCFQQNSFAAGLFPGDVVRSVLCVLVMLT
LAWGVMLGRRAAAVASIVFYVLTALTAVVYYLIVPIRSFLAPADGDASTALPPGTLLTCAVNVLVPLIYAIALGVALRNF
SVRTHRRTLSLSVTVLIVTLLVCLTVYLVFSFTHAQDFVPHPDARMLFEDLPARLLPAGYLAATSLTFAPATALASVIYQ
GVGMVFWLVLLVVSLAWLRSSIDYDHAAHEQAETLVEHGGESMSFMATWEGNEYWLSPTGRSAVAYRVLNHIALTTTGPF
GDPEEWFSDLDDFSRFCSDHTWAPVFYAVHEEQKDYLQEQGWHSIMVGEEMLIDPQAWKTTGKKWQDVRTAINKAKREGI
VDVMTTFDEAPADVQSQIEGISEQWSQGKALPEMKFTLGGVEELKDPRVKILYAIDGDGVVQAVTSWLPTWRGGHVIGWT
LDFMRYNHGSYNGIMEFLIARMAQRMHDWGEAHPDEQVQFVSLSAAPLSGLQHSSDATSDDTSNIDGTTVLQHSLALVAD
LLEPAYGFKSLYRFKLKFQPIQRPVYICYRDSALLPNLAIAIIRAYLPSLTFREALGMLSSFKPKDDAPASADSPSSAPA
ASSAPSPASAPSD