TCDB is operated by the Saier Lab Bioinformatics Group
>WP_105205467.1 hypothetical protein [Neobitarella massiliensis]
MGVRGMRLLKKNIQIFCGSAVTVLELGTVLVLFTLNNAQIMTRYVDTIRCVTKMLAPQVAVFVAFLFMSYEFFFKVNDTG
AGEFLQSLPGGRARQLLSGLAVMALAVGLVFLDFLGFGLAAMGREGILHSGVMARHVAAVFFLDIFLVGFFACVLGCLVA
QFQRRITGYSLLFGCCMLFTPFLQQILSSLSNEKLPIINLGDLFELKYPLTLEMFEPVYGFANEPERWGRMVFWLLLALA
ALLVYMLWRHLLRLRWLPAAAVCAVLAGWGLLTYAQGGCVMYMGENNLRGRDEDTTFSGSSYYEYNKGFIKDEPESFAVT
DYQMRLRLDNQLEAEVTMALAGTEGRSEECYRFTLYRGFTVTEVRDETGRALPFNRESDYLDIETEQPLSAVTICYRGYS
GKFYSNRQAVKLPAFFPYYPMAGYRPLVLRESGMEYINTCPEGERFFDITIQGGPEALYCNLPGEDGHFYGVAEGPSLLG
GLVEKKEIDGIQVVYPISQRFLYTMTYGYENTRVDAQLPMGQVRAQYDRLCEQVGQPPQRLAEKTVFYWYSSSSMTVGNE
TVAIFADHVLLEIWSLSPEKMAAYLLAGELQDKTTDDYPLLRSTFTVSYLSDKSIFNRSARSALKDIRQNPDTISGREET
VYLYQAAERWGDQAVSRAVYEFLRDRSDQRPAAEFLKQLVEEGPA