TCDB is operated by the Saier Lab Bioinformatics Group
>WP_111326133.1 hypothetical protein [Thermosporothrix hazakensis]
MFRMVQRVGVVALFECLLQWRALSFWLLIILASAVSVIPVLVLGTGISLPVLEVNVYTTRASVVLLLLPFVFTSVFQRDV
RYKMHPLLQVRPLLSFEYMLGKSLAALVLGLLAVLLTLCGSWIVLSAIRLELVSPFAALPFLLVNGAMCLCFTLLFVAVI
ALIDVPFLGAIFCSGAMIVLNLSSPATPLHMLNLHKNTLFYSSSIGFGPDLSLVLNQGGFFLALALGLFGVVLLLSQMKT
RYGMRRWYHLGVALLLCVLGGGLMLPITSAFGQTTKQYLDLGVPPAQPMNAIVSHYQLDVTAHIHSGQLEGKATFQLQSG
SEKELLLALNPGLQIQRVTAGQQPISFHTQQGWTRLTLPSGKALTLTLVYAGKLTLGRENYVGPAGGMIDVLGRPNAVYR
FLGQGMGVLDGNGAGGWYPLPYVQSLVEAYGSRLPFDRVSVRLPEAEHVWQAAGIFKQETRQIEVTKPGYLPSVFVVAFD
TQQQMRLDQTPLVYHGIQPDHKALSTYRLMSRLFNELRNWLEPQNKQPSTAIVLPFLREPVISTHLLLLPEHSLYSSFPI
DLEDETVISSFVGEKVAAAWWSDALLQEMVLAKQNATTGQPHGFSFFLEWPTNLKGMLSAYSAINMTGRILGTTYKERVY
QLCLERGEYGDKAKMKPEDMAKLSVVSEKIQKLGLSDCPLPTVGLMKLEKKEGEAKITQVLQRFLTAHQQDMRAPTIQQF
IKEAGVTLGRDVSADFKPYVPEEMPKP