TCDB is operated by the Saier Lab Bioinformatics Group
>WP_118450850.1 hypothetical protein [Butyricimonas virosa]
MNQYYLNLFVRFTCKILLRSKALWVCALLTFCCVNLFQIYFQSNFIPDASPIGFTAELRNYAFPELMPYMSVYLFSVLQT
IILLFFSVAFLHNGLKKGSMDVIFYRPESNVEYIWGTILGFILIFGGMGLMCLLGGGLVHLLWSESPFVIEYYFFYYFTL
FLPGLLSWLGISFSVTFLTKERGISVMFLLILYFFITFYTTRFQGGIFDILGIGLPNVFSQATGHSCLKLYLLQRGCWLL
LGIGLLQGSVMLFGRIPNNPLKTRMRMITCFLGGSGCLLGVIFFQAYRDANFKCQVYSETYAKFEPLSRATVLTHDITFQ
RNKNRMKATSAIMLQNQRKETLHEVIFYLNPALEIESMKWNDEEINVEREYQVIRVKKQIQPDDTIRVEMNYEGEIDENV
CYLDVPNVRLQDMDKHIACPVGKRYAFLGSDYTLLLPEVLWYPVTEPPLNTVFRNRVSKNFTSYSLKVLGESDKVVISQG
ERVPGDGYTFFRNSYPLTGISICIGDYEVRSIRVDSVLYELYLLKGKFVPESASIRKPHGTLMPEFLPEMKAFCEEKVGR
KYPYNYFRMIESPVMFTSYYRVHKKGSEFVQPEIVFFKERGKSNYVEKNAFYFSESLRLYLESWLNYDYRDKDIFTWNRL
LEHQSDELKSAFKNVNTEPNLYNIFPMFYWQVNDMHSGDYPELEMAFFLLAKYFEDTCGSQMVVNQNKMMDMVALDYLRS
QSLADAVVDKTLHLEILNQIFNVKVNELLDRVVANGVTEEQLSVFISSLMQKYRFERIEYEDINQSFSDEYGVNLSAILS
AWHKNAGIPVYIVEDFDVRRIGEDRVDQAPLVLVRFRIFNDSDVDGVVNIQSSRVPFLPGAVTSSIYETKLVNLRFAIPA
KTGKHVSLLLPDSPDYYALKLNVCGNIPDRIYTKLYSRAGDFDTLQYIREFDRACIQADTNEIIVDNEDPGFQVIKSGAN
YRFLEKEEQGITDKYRNMTHWLVPDDRWRYFIDDNAYGKSVRSAVIRESGKGVTCAEWSVDLKREGRYEVFAYLPEYTYS
QVLTKNRNPDVISLPFTYIVSSANGEEEVTIQAKQKHEWVSLGVYNYTPGHYSIKLSDKGETDYSIVADAIKWVYMEQ