TCDB is operated by the Saier Lab Bioinformatics Group
>WP_127038916.1 MULTISPECIES: hypothetical protein [unclassified Sporomusaceae]
MSGVAQMFMPLLLFLAAEVVTRGKRENFAALSVSLPFPSFGLQLGRALSVLILFVLLGLELVGSMLIVAGTALPVYVSFS
AVGAFVVKYLLACINVIGVTFFAASITNHLRYLYSLLLGWWLTGIFLAGNTGTILPIELAAVSFSSISGFGGNPSEVSGL
FPNEKLIQAIMIAQTVFSTVLLVGALLIENIRQQKSQHILKVNLLIWMMIFTAGGCFIWQSYRVNDVESNAVMRLDAAGP
LGITQSPAMEASDYNLMIQLIENEHFLSAKAQIKLKKTGDVTPRLLEFTLLDYLKVAQVINLATGEPLDWQQQGTYLCVI
PPASLTDHKEVNIEITYSGHVWEWTTDLYGRPVGLDNFVAAPITYLRGGAPWYPVVGRQAVYTASHYTLPWSNESRQVIQ
RSSVLHSPANVHLTVDIDSGATAISNLTPLEKQINGKQHQQQFFASNCRNVFLLAGPYEVAAINIDQRFNVDFYYFPGHI
QNLSSIAKGYSQMISYYEGLIPRDMGSGDAMPKTYVIFEAPRFLSYDNLMRTNNAGFTDAVPIPEAVSLTKALQSSWWSQ
PSGRVLTQARILNLWWPNCFSQAQGTIADGLALYMYTLYMESKQGEKFYHQASEYWRTYDDRTPEYGEALNLRGLVVRDV
FLLLDTIRQSKLGEAGVKQFLRLIHSSYQHKRSIEIADITAALEEIGAPALGKNNSRDNFREICEDLARVLAKQEDHQLQ
GTLSIKLNWDFSPEIKVLR