TCDB is operated by the Saier Lab Bioinformatics Group
>WP_128121392.1 EAL domain-containing protein [Pseudomonas zhaodongensis]
MTSYAFVENATVLLALCWLLSVTARHWGQSHQLWAQCTAGIWFGGACIVGMLMPISVQDGVIFDARTVVLSMAALFGGPI
AAGIAGLIAGAYRLWVGGPGVWVGLINVLLPIVLGLVYRHFHRRGQIGIGACQLLLFGLLLHGGVVASLLLLPAQLVAPT
LEQVAAPMLLVLPVAVMLLGLLLADLLKRDQIERAMHLSEARLRAITQAIPDVLLVLDEDGRYLEVISNGSAPLQEGDQS
LIGKTVEDVLPPRHAERFRELIRETLSRGAPGLLEYSTQTVNGLKVFEVRAQRLQLAQPYKPAVVCLSRDISERASAEQE
RRIASIAFESQQGMIITDAKNRILRVNQAFTEISGYSADEAIGQDTRLLASGRHSPDFYLAMWRSIQQTGAWQGEIWNRR
KTGEVYPEWLSISTVLDAQGAVSNYVAAFTDITERKQAEERIHNLAFYDPLSGLPNRRLLLDRLKQALAATVRSQQYGAL
MFIDLDNFKNINDLHGHQAGDQLLCIVAERLSGEVRGVNTVARLGGDEFVVMLEDLDANAEYAAAQAEQIGERILSALGQ
PYRLGSLLVHSSASIGVVLLNSNDGDAEELMKRADMSMYEAKQAGRNALRFFDPRMQQAVQERLRLEDEIRRGLTAGEFV
IHFQPQIERHRGLVGAEVLVRWQHPQRGLLTPFHFIGPAERAGLIEALDFVVLTQACEQLATWAKQPSRAALTLAVNLSA
SLLYQADFVDRVLALLKRTGANPRLLKLEITESLLLDDMEEAVVRMRTLKQHGIRFSIDDFGTGYSSMAYLQRLPLDQLK
IDQSFVRQLVEDASSQTIIRATCALASGLKLEVIAEGVETEEQRTLLIANGCDMFQGYLFSRPVPLEAFEALELEPVT