TCDB is operated by the Saier Lab Bioinformatics Group
>WP_146038958.1 hypothetical protein [Sulfobacillus sp. hq2]
MISRQMRAEMLVLWRYHWRSRSWWLWLAAAGIWPLTYVVFLGGHGMAPLTICLNLAVIPVAPLLYVVLGTRLSESEHGNH
PLRISRSWPVYPGIRTTGQALTVLAISLMSALVTFLCSLWQVPTGFWSNSAWLLYTARDGIGILFVNTLFMLSFGYLWGQ
WLFSIWKSVIALLILLIVGLATVVAVQAGFLTGWFSGWVALYQWTPFSWLTDTLSPVWGFGPFARDLSLLVGWVVLLTLA
WWIVAWAGISRTRWSETLAGLGVFTMLALSFPLAKSLWHQTQGITQNQVISWAHQGPKGPVAITASHLSLDIGHGTWLKG
HGVFHVTSQRPVPRLPLFLNPELHITRITVNQHPVIWHMAHQRGWIWIDHPLHQGQTLRLTVVWAGRFLLLGEYPNTITA
FSSTQGAILPAATWYPLTANPKRQAWQVDIHAPRDLVVVSGYGFVNKSDSVKGNGPSMELVLGHLTRIPYKGPVIYASSD
QTALIHHVLHRSTALNRLMRNLGPPYFGSLVWNGAMEWEPPFVSLSRAPWPSVNSDLSYPAYPGIGTALSDNTINQPILQ
TASGLPRHLLNLWLTEGRGGIQDNSVTHHLVSAMLARYVLAGNYRLGPLIEQVGKLSPAGFHWSAVQFRHLLKRAPLTRI
QINHVLEQAQVRYPEKG