TCDB is operated by the Saier Lab Bioinformatics Group
>WP_147581693.1 DUF1761 family protein [Flavobacterium alkalisoli]
MNFNWLAILVAALSTMVVGFIWYNPKVFGTAWMKETGMTEEKAKGANMFKIFGMAILFAFLISFILQFLVIHQFGPSGMV
GGPEFFETAKPSYKAFMTDYGDAFRTFKHGALHGFMAGLLLALPVTGTNALFERKSAKYILINGGYWIVCFTIIGGILCA
WPA