TCDB is operated by the Saier Lab Bioinformatics Group
>WP_147661947.1 hypothetical protein [Candidatus Prometheoarchaeum syntrophicum]
MALPIETYLNGISAFCVLLTGFYFGIRFIIHYNSLKKSLLPLIAGLGIGLAIFYLGPSTAFFYLLFTGENISYILYGFLS
YFTLPLTLILAMYLGFDIFKPSWKKGVMIFFSIFAIIWWVSFLFLRDYVFEASDSIGVGDLMDISYVLPIGLPMVAIAIL
SAMFLLGGGFLSIARKIEDKTKRKKSLFLALGWVLFAIAGILDTFLAPSLIALARLTMLIGYLLIFSGFTPVYNKED