TCDB is operated by the Saier Lab Bioinformatics Group
>WP_190123923.1 DUF3068 domain-containing protein [Streptomyces inusitatus]
MRRTASPVPLVLLGVGTFLLVLAAMLAWYVEPRAQRTPIDTDATTVFTGRGSYFDAKKVKTVDGTKLTVTRKVRGDVADS
EESGRAVWDVSTSVDTDDTLPASDTHDSFQWTVERWVTDRRTNTPVHCCEESPRFEGEAYLKFPFNVERRAYRWWDSTLG
GTVELEFAGGTKVQGHEGYRFTGTVDPVRTGTRQVPGVLVGLPDRGQVLAEEWYANHGIELVADRKTGRILFAAIGPRKT
LRAPGAVSGGNEVVLLESERIAFTEETQKKQVELARADNRKFRLLGLTVPVGAGALGLLLAAAGSVMVFRGRSEDTGAVP
APAGEPEPFTR