TCDB is operated by the Saier Lab Bioinformatics Group
>WP_196973084.1 DUF3068 domain-containing protein [Corynebacterium diphtheriae]
MKPRLSPSGIAFVTAAVLFIIAAVVPALVTALLKPIPVGIARSITTQPAATVMVDPACAEASPLSCPHVETTTQLRREVT
TKKTEVRDEVDLRVNEALRRTDTNEDIITIDDSLRLIRHSTYPVIDSTSHMKVKSQALNLNFDTGDFARDGLQYFFPFHT
ERRSYQFFDPIAQKTWPLDYVQQDNGEYVFTQTVPATNLVKAATRSYTQPDDISDEHSTQAQASDLSPEQQKQLAAMQVT
DPQGSALLTPYYTTTRTLWVEPKSGVVVNQEEDVFMFYAGSQREADRIVASGHDDELAKERTILRTSLNWDADTQANARA
EARPTVVALKAARVGGFLVKMAGVAALIIGVLLASRRRSEPQCR