TCDB is operated by the Saier Lab Bioinformatics Group
>WP_212021133.1 porin PorA family protein [Catenulispora pinistramenti]
MTKTRIACAAVGVLSLVAAALLAWWITPSYVARIPSGKNIDRTYDGTFQSLLDPQALASGNLLGAVKQNVPMTVAQDVKV
EKTSGNKALISDSRTTSAAGAKVEQTKWQYAVDRKSLEAVSSHPSSWTDLIPAQGLTVSWPFGAQKKNYEGWTPETQKVA
PLTYLRSEKKQGITTYVYQAKVAPTKIADPQILATLPKELPVDLLKLLGTAGALPAAQAAQLAQILPELPNPVPLSYTFQ
DDSTFWVDPHTGLVIDVQRAQQRVAEIALPNGTTVPLIPAVAVTYQDSAASSKAAADDARHGRTVISWLGVYLPIILLAL
GVVLLALAGVLRGRRRPAARASGPAAGTGPGTGPGSTVPPTQE