TCDB is operated by the Saier Lab Bioinformatics Group
>WP_246122516.1 DUF3068 domain-containing protein [Actinoallomurus bryophytorum]
MRFYVARQLIAAPLNVYEKTTLRADGATYLDTTQWKLQKGATVTATNTTRGDVHAGDGKVAVWDSFTSIEDTAANAKIET
QAQRAVFDRRTAQLRDGRGASVNSDGAVKQTGVGLFWPVGVKRKSYPYFDTSTKRAWPMNYEGEEKVQGIKTYRFVQQIP
PTVTDSIKPGVPASLLGLPAAQVSKLPGYDKKNNAVAVDRVYQSTVTAWVDPRTGAPVNQEQKVTQTLRTSDGVDRLVVA
DLDLKMTPESQKSLVHTSNTEATKIGLVKSWLPYGGGGLGLILLIAGLLLLVSARRRPAHRAVGSGTSAGNGAKAEDTEN
ADGPRAAGDEPADREPSSES