TCDB is operated by the Saier Lab Bioinformatics Group
>tr|X1WXB1|X1WXB1_ACYPI Uncharacterized protein OS=Acyrthosiphon pisum PE=4 SV=1
MADSEGSSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCYLENIADKNIPPDLSQCVFVIEQALSVRALQELVT
AASSQEGKGGTGSGHRTLLYGNAILLRHQNSDMYLACLSTSSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVR
VGDDLILVSVATERYLHTAKENELSVVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSSWSDVS
GQNIVIYEGGSVMSQARSLWRLELARTKWAGGFINWYHPMRIRHLTTGRYLGVNENNELHLVCREEATTASSTFFLRQEK
DDQKIILEDKDLEVIGAPIIKYGDSTVLVQHSDTGLWLTYKSYETKKKGVGKVEEKQAVLHEEGKMDDGLDFSRSQEEES
RTARVIRKCSSLFTQFISGLENLQSNRRSSLFCSFVNLNEMVMCLEDLINYFAQPEEDMEHEEKQNRFRALRNRQDLFQE
EGILNLILEAIDKVNIITSQGFMVSLAGDESGQSWDVISGYLYQLLAAIIKGNHTNCAQFANTNRLNWLFSRLGSQASSE
GTGMLDVLHCVLIDSPEALNMMKDEHIKVIISLLEKHGRDPKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTL
LVDHVASVRPNIFVGHVSGSAVYRKWYYEVAIDHVEQTTHLNPHIRIGWANTAGYVPYPGGGEKWGGNGVGDDLYSFGFD
GSYLWTGGRKSEVMPGTQISNIKKSDVIGCALDLTIPIITFTLNGQLVQGAFRDFNLDGMFFPVISCSSKVSCRFLLGGD
HGRLKFTPPDEFSPLFETLLPQQILTIDPCFYFGNLNKCVLTGPWYVEDDTAFVPNPVDTSMVTLPSYIENIKDKLAENI
HEMWAMNKIEAGWQYGDKRNDTRKFHPCLIQFDKLPPAEKRYDSQLAVQTLKTVIALGYHISIDNPPSRIKTVRLPNEPF
MQSNGYKPAPLDLSAIILSGKMEELIDQLAENTHNLWAKERIQQGWTYGLNEELQMLRSPHLVPYSKVDDAIKKANRDTA
SETVRTLLVYGYNLDPPTGETNEATLLTDDNTNRYLTFRTYRAEKTYAVSSGKWYFEFEILTSGPMRVGWARFTCSPGYQ
IGSDENSWAFDGYNEEKIYMGTAESFGRQWQVGDVVGVFLDLMDHTISFSMNGELLMDTLGGETTFSEVQGEGFVPAFTL
GLGQKAKLTFGQDVNSLKYFTTCGLQEGYEPFCVNMKRPVTYWYTKDQPIFENTDDFSSVIDVTRIPAGSDTPPCLKISH
NTFETMEKANWEFLRLSLPVICLPSFIDEQEKQRRWQEIRIRQHRLLSQSEHATPAHIEQIMKSGFSMSDIKGLHRGYSD
DPVENDEMMPNATPLPPRGKNQPPPPRPPRKGSLSRHDDLTIENEGKLNRSSSELNFNIYNHQNGDGQDINKDDKKKRGR
SPFRFFSRKKEGPSDNPKRAKTPDPVRNVDRSRNAAHRPNTLNERVTPQIRVSQMDLKLVPPAIPDRPGGPKAMSFTPTS
AGIEFVGNEIFDLECLKLINEYYYGVRIFPGQDPTHVYVGWVTTQYHLHTKDFSQNHVRKSTVTIVDEHNRILESIDRQS
CYMVRSDELYNEVTNDSSGKGASQGMAIGCFIDIATGMMSFTCEGKETSFKFKMEPDIKLFPAIFVEASSKEILQIELGR
TSTTLPLSAAVLQNSERHVLPQFPPRLKVQCLRPHQWARVPNDSLHIHTLKLSDIRGWSILCEDPVSMIALHIPEEDRCI
DILELIEMEKLLSFHAHTLTLYAAVCYQANYRAAHILCTHVNQKQLLYAICSEYMSGPLRQGFYDLLIALHLESHATTME
VCKNEYIIPLGHELTTLYDDPQMGHSLRSLQTESVRPQMKMTEISDVIDNVRNLYSPYFPLQVVREYVMAALEEAVLVNQ
VHNRDPIGGSNENLFLPLLKLVDRLLLVGMLRDEDVEKLLIMINPETWDPEFQKDGPDEHRKGLLHMKMAEGAKLQMCYL
LHHLCDIQLRHRVESIISFSYQFVNDIQIDQLRRYNEIKQSDLPSAVAAKKTREFRCPPREQMNAILGFKNLDSDDKENC
LIGDDLRERMNEFNEKLMKQISLVALQESEDDKSDLNNLNNEGKIKQFYNFINAVKDEGNEDGLNEQEKKIPEEIFRKVL
ISTIVSWAEETQIETPKLVREMFSLLVRQYDSVGELIRALEKTYVINFKTKEDVAQMWVGLSQIRSLLPVQMSQEEEELM
RERLWKLVNNHTFFQHPDLIRVLRMHENVMAVMMNTLGRRAQAQSQPGGTPVTGQDGEIVPKEKDTSHEMVVACCRFLCY
FCRTSRQNQKAMFDHFSFLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAIYLSRCGLQSNSELIE
KGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLLRAIIDANKMSERITERRKF
LEESGNQENIQLDHPLPESDEDEDYIDTGAAILNFYCTLVDLLGRCAPDSSVISLGKNESLRARAILRSLVPLEDLHGVL
SLRFTLQNPAAGQDRPKSDMPSGLIPGHKQSVVLFLERVYGIEMQELFFTLLEEAFLPDLRTATMLDRNDGLESDMALAM
NRYIGNSVLPLLIGHSKFYSESDNYANLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSQMQPSMLLKLLRKLTVDV
SNLSEYTTVALRLLTLHYDRCAKYYGSTGGQGIYGASSDEEKRLTMMLFSNIFDSLSKMDYDPELFGKALPCLSAIGCAL
PPDYSLSKNHDDEWYGSKQNIQGPSDGPYNPQPINTNSIVLDNDLNSIVHKFSEHYHDAWANRKLENGWVYGEQFNDVNK
SHPRLKPYMMLSEYEKELYKEPVRESLKALLAIGWSIEHSENDAPLNNRGSVRRQSKSNENVTPFDYHPNPIDMTNLTLT
REMQNMAERLAENSHDIWAKKKKEEVMLCGGGIHNQLVPYDLLTDKEKKKDRERSQEFLKYLQYQGYKLHRPNRNGGPSE
AEQLAAASTGELRFSYSLLEKLIHYIDRASINMKLLKPSGTFSRRSSFKICTRDIKFFSKVVLPLVEKYFSTHRNYFITV
ATASSVLGAASLKEKEMVASLFCKLANLLRSKLMAFGADVRITVRCLQVLVKAIDAKSLVKNCPEFIRTSMLTFFHNIAD
DLEHTIQNLHDSRYCYLRGTHLKTSTSLFYVNDVILPVLSSLFDHLAAYEYGNELLLNEIQVAAYKMLSSLYTLGTDTSL
THDRKYLKVQLERHRPAFGSCLGAFSSTFPVAFLEPHLNKHNQYSLLNRFADSSLEAQDIMSRMEGTMPTLETVLNEVDQ
FIESEKTYADAPHIIDVILPLLCSYLPYWWAQGPDNVALTTGNHVTMVTSEHMNCLLKNVLKLIKKNIGNDNAPWMTQIA
AYTQQIIINSSEELLKDPFLPLAERVKKRTETLYHKEESLRGFIKSSTDDTSQIEAQIQEDWQLVVRDIYAFYPLLIKYV
DLQRNHWLRNNISNAEDLYNHVSEIFNIWSKSQYFLREEQNFISANEIDNMILIMPTATRRSAVISETSLGGSTGKKKKK
HRDKKRDKEKEIQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRFLKRMPDYDVIQFVKIQLTLPDKLDPADEMSWQH
YLYSKLGSKKGTTEIKPQQVDEVADRIVAMAKVLYGLHMIDHPQLQSKAIYRSVVSTQRKRAVIACFRQLSLHALTRHRA
VNIFVRSFYELWLQDENIGQEVMIEDLTQSFEEAELKKRDKEEEEGMADPLNQMVTTFCRGAMTERSGALQEDPLYMSYA
DILAKSCGEEEEEGNNEEEGSTGNGEEEGGASIHEQEMEKQKLLFHQARLANRGVAEMVLLHISACKGIPSEMVMKTLQL
GIAVLRGGNLEIQMGMLNHLKEKKDVGFFTSVAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCTLFR
FIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDPAGKANFFKAIGVASQVFNTLS
EVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVD
TLVESASNVELILKYFDMFLKLKDLTSSASFTEIDPNNDGWVHPKDFKEKMEQQKSYTAEEIEFMLQCCESNHDGKIDYI
GFTDQFHEPSKEIGFNLAVLLTNLSEHMPNEPRLTRFLETASSVLNYFQPFLGRIEILGGSKRIERVYFEIKESNIEQWL
KPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVDDGSGIGGGKSRKTAYTYMADDEENKTAKDPI
RRGIQAIKYGFHLLFFVLSPTNIKNKINEIQQMSVIELITSFFKLWFYLIFYTGYSGVYVLRYISRILMQLMSGTQSEET
TVEVVEEKSGSFRMLPALPSSGMDEPPSTLTDGNNMRKNSGSPDSKHLKSNSVGDDKDETSAENHEKEDGVDGSEQQASF
VDLLVGESARKDSIAGPEVLAQQQAVMAAVEAEIKQKNSVENPSAFSTIDINAYTHRALSFLARNFYNLKYVALVLAFCI
NFILLFYKVTTLADDLSDDGDVKEFALGSAGISNDDMDDSNSTEIADDEGVLELVHVNEDFFYMAHVMRLAALLHSLASL
AMLIAYYHLKVPLAIFKREKEIARRLEFDGLYIVEQPEDDDIKSHWDKLVISAKSFPVNYWDKFAKKKVRQKYSETYDFD
SISNLLGMEKTSFSTQENEERTGLINFVINIDWRYQVWKAGVTITDNAFLYSLWYFTFSILGNFNNFFFAAHLLDVAVGF
KTLRTILQSVTHNGKQLVLTVLLLTIIVYIYTVIAFNFFRKFYVQEEDDEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEI
GSPDGDDYEVYRIMFDITFFFFVIIILLAIIQGLIIDAFGELRDQLESVKEDMESNCFICGIGKDYFDKVPHGFDTHVQE
EHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRCWDFFPVGDCFRKQYEEELGGGGGV