TCDB is operated by the Saier Lab Bioinformatics Group
>tr|X6M894|X6M894_RETFI Uncharacterized protein OS=Reticulomyxa filosa GN=RFI_28142 PE=4 SV=1
MTSFAIHKQIEYELWKVLITKKVAKKETLDKSKINDCLSPFRVIMREKCLAWEVLNGACDSDEKLMESYKIIIMDEMKQH
CNETIATVDQLLLVADNTESKVRCWKMAGDFCRAISRRETRNAESWTTRCKQYYETAWDMAQNSLCACDHVLLEVALSLS
KLYYDSGQVQEACKLAYDARVAAIEDIFNCREDALSRGATFCGGPPAPFYDLEECLRCWTGEESNENEHQDEE