TCDB is operated by the Saier Lab Bioinformatics Group
>XP_005723758.1 PREDICTED: cytokine receptor-like factor 1 isoform X2 [Pundamilia nyererei]
MKGVLDFCLIFLTLHIPGVVSLSTHVAIIYPQDPVLRIGSNLTASCWVHPELGVHASSLFWTLNGQQLPSSFYRVLSATN
LSVTLAGLNASKQTSGDNLVCHNHKGHILAGSCLYVGMPPVKPVNLTCWSRNTKDLTCSWAPGGKGETNISTQYKLKYKL
RWYGTEKECADYTHTQPYSCSITQDLHLFTPYEIWVEASNQLGWATSDVITLDILDVVTTDPPSGVTVSRVGQLEDQLSV
RWEAPPALKDFLFQAKYQIRYRLEDSQDWKVMEDVGNQTSCRLAGLRPGTVYFVQVRCNPVGIYGSRKAGIWSEWSHPTA
ASTPHSERMMSGSCDSKSSGDSNSTLRRELKQFFGWVRKHAYGCSSMSMKLYDQWRVLMQKSHKVRNQVGSPRG