TCDB is operated by the Saier Lab Bioinformatics Group
>XP_005758190.1 hypothetical protein EMIHUDRAFT_107168 [Emiliania huxleyi CCMP1516]
MAAQRLECPVCLEATDGPQHQCREGHVFCASCDSNLRAPRRCPECRMALGPLGQAIRCRSHEERIAALPAACSHCGLATT
RGDVAAHEQGCPQRPRACAAAEAGCAWSGLLADKAAHEATCPFAVCQRMMAPLVAELRAENERTEVAELRAENERLRSRV
AALEAGEGGEEGGRWVRQRVGAAPDGAPPSNAAVQAMDVAAATAVLRAHVSVSRVAAAACMRLANLCMEDQNEQLAAEAG
AIDAIVAAMQAHPQVAGLQKQGCCALANVCSGDDAAALARKQRVADAGAIEAIVAALQAHPQEAGVQEQGCRALRNVCSG
TDAAGLARRQRAAAAGAIEAAAAAMQAHPQVAGVQGQGQRLRDLLA