TCDB is operated by the Saier Lab Bioinformatics Group
>XP_006559331.1 uncharacterized protein LOC100576840 [Apis mellifera]
MQIRMAESIERDDLNINKQNHQKYNMGDEISIFLVVFLAIGGIIMMSALLACYACIFRDLCCRPEDRSKRRRPQSPRHEP
DDPNRPRLDAILLNDITQGESMPTESEKV