TCDB is operated by the Saier Lab Bioinformatics Group
>XP_008102640.1 PREDICTED: small integral membrane protein 5 isoform X1 [Anolis carolinensis]
MKTLETAKPPVLQHFRVFSCCQDRWIKVYSVAKRGLIQTMSYKDFQNELYAIGNKLWLKLQRLPKAEPVEIVCFSVIILF
IAVILSMMIIACSCCCGQCCSGSPKKKSRKIQVRPVVHA