TCDB is operated by the Saier Lab Bioinformatics Group
>XP_008210033.1 PREDICTED: uncharacterized protein LOC103316705 [Nasonia vitripennis]
MAIEDTSIFLVVILAVGGISMMTTLLACYICIFRDLCCRSQPFKSTKNLRRRARTKKRRKKKGDCANQQKPGSADIVTLY
DLTQPADISMPTESENL