TCDB is operated by the Saier Lab Bioinformatics Group
>XP_010916338.1 putative E3 ubiquitin-protein ligase SINA-like 9 [Elaeis guineensis]
MARFSLEDEEEEMADGRRRKKRSGGAEEIDRRSPKRGKKLKTKGKKEMGNEVEGEEEAEVAAVEEEGGEGGDVEEEEEEE
EKEAEQGDGGMSFGKENGDGVSVRIDPDVLDCSICYEPLRPPLFQCSNGHVACCSCWSKLDHKCYLCSHEISFSRNLALE
KIVESIKISCRHAKYGCRRTINYTQRDHHEETCIYAPCHCPVSDCTYSGSTVMLSAHFSSKHSKSSKRFCYGQPFKVNLK
PMEPFFVLQGEDGHLFLLLNNRDVAVGYALSVACIRPDTPEFNFSYKLTASGKESSVRLKASTTNIKEWKGVYPTKAFLL
VPHDLFYSSGIMLLDVCIRKSNLVL