TCDB is operated by the Saier Lab Bioinformatics Group
>XP_012787199.1 PREDICTED: small integral membrane protein 22 [Sorex araneus]
MGDLEATAQDVLETLRTKELFQTPWDKAAFVIFLIFTCTVLLLLLLVLIRCCCCCCCCCRRQPRQQQVSPKQQWGVDNLA
MEP