TCDB is operated by the Saier Lab Bioinformatics Group
>XP_014682163.1 PREDICTED: LOW QUALITY PROTEIN: vomeronasal type-1 receptor 5 [Equus asinus]
MFSGVETTDSRSQTLLDIVVTIGKLAEMVLLSSDLLFFSTDILFXKTCMKMTKLPSYINTKNFFYPQASFGISANTFLLL
SHVFTLAFTHRVKPIDMTVSHLSLIHILLLFTKATLVSSDLFGSQNVQSNLGCKVAVFLSKVLRGLSISTTCLPSVLQAV
TISPSSSSLAKFKHISPNHALGFFLFSWVLNMSIAATFCSTLRPPPVGLGRSSVCHEALLFFAREQYAQEHVLHPSDIER
CHLPRVHGPLXWLHGDHFVXTXRGCPNTFTAPASPRVSPAKRASQTVLLLVSCFVFVYWVDFTFSFSVVVTWMNDPLLVW
FQILVVDSYATISPLVLNPSR