TCDB is operated by the Saier Lab Bioinformatics Group
>XP_015636261.1 E3 ubiquitin-protein ligase SINA-like 11 [Oryza sativa Japonica Group]
MSSGRVGDRIAIPAAGTARRRRRDPTTGPESPVYLEGSRWSLSPAYQPSRRRRHDEEGYSRRRGRSRSNSPRRRRRRRPR
SCRSRSRTRSYECEDSRCCHTRPSPRSDDREDDDDEQDGSWYHPPADNEFTVRIDGIGADDGIFRCDGCFAMLSSPIYEC
ANGDVICERCSYDDGGARVCRKCGTMELARSRAIGHLLRCIRFACKNRRYGCPSFLPRQDMDEHELSCDHEPCFCPIRRC
GFAGAADSLARHLTARHGWGRLRVAYGEAAVVPVQSPTILRADDGRIFHLSCTRERGGGGGTAMSMVCIRPDHVAGAEEE
FTYEVRTACQRLQMQAAVEGTSLRYGMKDAVQARVTVPDDMLLRQGDAVQVFVRKATSAAGAANNN