TCDB is operated by the Saier Lab Bioinformatics Group
>XP_017310555.1 PREDICTED: interleukin-21 receptor [Ictalurus punctatus]
MATLYLDVLLLVFCGIIRQIDGVGYVSCTTDYISTLNCTCSGSENTLLCEIQANCSDAAGSTDGRCVIRPPHKWCTIQPD
NFFLIANPDTSCTLNVRHVNQQTNREEYASNVMSLDQMIKPQQPANLTLTKNNNEFNLSWEMAYKDYENVDLFGYLMYRV
RLRPKGIMDEKHFKVYNVGEDRRYQEIQCDLLSPGKVYTVDVQASVNSQMKNLDGETEWSEWSASVECTCPGNYDPLWYF
LMLPLVIGLIGFFGMCYRGLVKKPCLFQYIPDPYDFFKPLYHTYQGDFKKWVGPVFTFSSFDVLEKSAPLQVLSEKQQAA
APLQMPLLRDQGSGGSSLGDWSLLSLMNPDFSKRYFLGGSSLGLAHSGGHISMDTVTVSGQEGAMSDFQETNRNAVEVPD
EDPASDSRGRSEGQGFDDWQLQANDAENGEELSLDSFSSNEHSDYGYPQIGLDLDTIDSGFLESDCSSPVGSECEGGERM
DSALLGGPVGTHSNYVKQWVAFVPGSGENSNSL