TCDB is operated by the Saier Lab Bioinformatics Group
>XP_018075493.1 hypothetical protein LY89DRAFT_778754 [Phialocephala scopiformis]
MEAPAQALTSFMNETKESSSQQYNDAHLIQTSKSDVQTSSPRSKRLRLNRTTIAFFIMGILIALPTMVVTMAANQMFAGI
TGVYGISLSLTAAITSFSTPLFARFLPYNICTFICVIFSLLSYTICTLPFPSPSSSITTSKAGPVLGTMFAGFVYAFGTN
TYLAVAAFFPQEAVLALSVGSGFAAVLGPATYMGFMVAFGQDWRRSFLVFLPTVLGILVAWWVLMNRKCREAAKRSRLGS
RGGKTIESMTSEAERDTGSEGDTESATAAGKVERKEGVCIQERESDTSEMLKTGFSPHRTRLGLLFQIILPKYVAPLIIC
TTSAVETLARFREAPKGDLQFQISSPTETHNLSSAPSSLFYHIPFIWTWTILQLILLTIGIIQLYHPFLTYYEVWVMVMF
LVGGCVGGGFISTNYKVAEDFRKAGEPDEVRSFAMSYAGLGNFGGDALGGGLAVLLQQLVVKSIGSR