TCDB is operated by the Saier Lab Bioinformatics Group
>XP_018900147.1 PREDICTED: transmembrane protein 237 [Bemisia tabaci]
MSAKSSSGKSGNDDDKAPTSARTENIRRGRQNVQNEMKDLIIEKKSELSKVLNEIKGDIVEKLDEEAIKSTSVSPELKKS
ETQLIDSYYIQQRNKFIKTTNPNIDQNINKSDSNLWLNTDKLGFRSPLDVALLFQRRVISPFFIACHGFLAGVAVMQLVL
AYYLISGHNFDQTTSETVFRVYQQLALVGPSCFAFFISICFMSILDRVDLFHIFKCDPRDWISYRRSWVIGLIYFCGLVI
NAVCFRYDHMISHYPSKDPTIVNFQGTSSPEVVTDWYKNQSISSLVSTWQILNAVRCVCAILGWILLCFSQTTDLLADHL
HEVKTFDLETDDKIVIDNRPS