TCDB is operated by the Saier Lab Bioinformatics Group
>XP_020863947.1 small integral membrane protein 18 [Phascolarctos cinereus]
MASVSTATLHATLWNETSGTSSPPTTTSAHRYIGFQVQQVYPFHDNWNTACFVIMLLFIFTVVSLMLLAFVYEVLDCCCC
AKDKTLSDLESEPSPLRTMMDNIRRRDTEVV