TCDB is operated by the Saier Lab Bioinformatics Group
>XP_022829708.1 uncharacterized protein LOC111358688 isoform X2 [Spodoptera litura]
MKPGKSVDVKDEIAEVHTSARSPSPIQKTKRSRSRSGSRKMSNGHAAPDETPASEEPAGDKSKRDSWIKSEHESLDTELP
IHDQIKQGILGFVEKELKNSDKNPSFVFYSHDPNHLDEKFMKTLSRPSSGHKEKRSPSYRKKKRHSSRHRDRDLHDFDIP
GSSLSALERVDDYLKEYKKDEVVTLSGELEIEMNDVENNNGISKELRNKTRKTRRKIRDERQESSVNGRDVSPKVFKSTK
NKTGTKPVRPTDLTTMLESLESSMPYHDQYIDNPFSSPSPLTSPNDERLDPFGSRRPEKIYLQGGGTFRAVSRDRILESQ
QSRDGDKYLRLGDLTPLDVALTLQKAWRSSAPACHGVLGGLSLMHLLLISYSDGLDAGHLSFHAVVTMPYVATYYFFCVL
CLLSVLDRLDVTSLDLTRGLQPYFQPIVLVMLYTACLLVCTAARMYDELMVYQYAPLVNNITSNNVTTPTIPTFYHTWTH
FSIWRAVLSILGLVYFIISNPQDLVFSNLSKLLQFKHSLQSIG