TCDB is operated by the Saier Lab Bioinformatics Group
>XP_023678700.1 uncharacterized protein LOC111849758 isoform X2 [Paramormyrops kingsleyae]
MRACVRVCAYERARVCVKSKSVCDSCLLFTCIYACVRTAVPRSTETHLGKGSRDTFLSPFINSSCVEPPCSVPRVSANPI
HPEHRVKGMAQAGQLDVSRLVVPALLMLGWIVGCAVVVYWVFN