TCDB is operated by the Saier Lab Bioinformatics Group
>XP_024131787.1 phospholipase DDHD2 isoform X5 [Oryzias melastigma]
MVDEESVPDPYKDVQPHWFFCRRADDSTSWLPFSREDSDKLENTYTTGNPDEEVVIAVDGERYDVHVKERKRYAVYWEQG
PTEVRRCTWFYKGDKDTRFMPYPEDFSKMLEEAFKDAVTSDQWKKKIDFPTGETVILHNPKLIMQYQPIGLQDDWISSPS
EQTRPRTVKRGVDSISIDIPDGEPDQVDHLVFMVHGIGPACDLRFRSIIQCVNDFRSASLSLLASHYKRAQQDGLVGRVE
FLPVNWHSALHGDATGVDEDIQRITLPSISRLRHFTNDTLLDLFFYNSPTYCQTIVDTVASEINRLYALFKQRHPDFNRA
VSLVGHSLGSLILFDLLTNQKTESEVPSGNPSFLSSNTLEQILTKLDLKQYLDIFESENLDLESLSLCKDSDLKDLGIPL
GPRKKILNCIKRRWLPEDCKAAATLQIHNAEDPGELSPEQSRFYRAQSVTSAVDYEYFNVGIGQNNGGIAKGQVSIDYPQ
LAFQPQAFFAFGSPIGMFLTVRGLKRIDPNYTFPTCKSFYNIYHPYDPVAYRIEPMIVSEVDLEPMLIPHHKGRKRMHLE
LKDSLTRMSMDLKNNVLGSLRTAWQSFARIPVAALPPVEEGEASADANSQEAQASAAGSNADANKGDKNADIWSKILEWP
WAIHTHYLKGVCVEAESSMNTEQTEESEIKVGMLNGGRRIDYVLQEKPIESFNEYLFAIQSHLCYWESEDTALLLLKDIY
DKLGVAFEQPQQ