TCDB is operated by the Saier Lab Bioinformatics Group
>XP_024740161.1 hypothetical protein K444DRAFT_523565 [Meliniomyces bicolor E]
MPKKLKPSARADQSYVPLISAPKRHSNGRRDVEAVCSKNLFSLLNYFCFFVIGLSMMWTWSMILQAVPFFHRRFRENPWI
LQYFQAFYLVFFAFTMLTVTLVLGSRKSRPSYTSYLGSALIAYFVVATLLMLSTLPCLNMGANIYFLFTLVMVVITAVAN
GLSQNAAFAFAAGFGRTEYAPAIMTGEALAGLLPSSIEIASALAFPSAYFEVDENNTSQTYYLTLNYFLSAAVVGSASLC
AFKFLVRRAPTHFHPKTTKRTSNRTRMASKLQWPALANFMCLCISSVSPVFISKIVSVVPVEKASIIFRPEAFIPLAIVL
WNVGDLLGSVMAVHSLFLIKYPRLLFILSLSRLVFVPLYLMCNIDGRGSVAGDWFYLIIVQFLFGLTHGWLSGASMMGVP
VWINEEDREEAGAFMGMTLVAGLVAGSMLGLAAAQA